Latest bandalling Tenders | Government bandalling Tenders

CTN :44340045

17 Mar, 2026 NA

Delhi - Delhi

Tender For tender for supply of ht cable -m and l for searching fault location of ht ug cable 11000 volts laid in trenches ducts with the help of electronic fault locating machine comprising of surge generator pulse echo fault locator with frequency distance calculator etc incl transportation of machinery excavation in normal soil strata exposing the cable fault removal of deteriorated portion of the cable treating of cable of any size including disconnecting and re fixing cables with lugs as per direction of engineer in charge note a charges of cable fault locator and dg set including transportation charges deemed to be included in the quoted rate b necessary testing of cable after making joint will be deemed to be including in the cost of relevent item , supply jointing and testing indoor type cold shrinkable end termination cable joint including all material and accessories suitable for 3 core x 120 minus 185 sqmm xlpe cable of 11000 volts e grade complete all as specified and directed note cost of cutting of existing end termination joint deemed to be included in unit rate , m and l for cable jointing kit for 11 kv earthed grade cable for straight through cold shrink type complete with joining material and accessory suitable for 120 to 185 sqmm 3 core xlpe armored aluminum conductor cable complete all as specified and directed , supplying and laying in repair xlpe insulated screened pvc bedded galvanized steel strip or wire armoured , electrical power cable heavy duty with aluminum conductor 11000 volts grade cross sectional area 120 sqmm x 3 core complete all as specified and directed , supply and fixing in repair mccb 400 amps 3 pole 415 volt 36 ka including under voltage over voltage relay with adjutable thermal setting 80% minuse 100% all as specified and directed , m and l for complete repairing serviceing of ht 11 kv vaccum circuit breaker vcb after disconnecting of all incoming and outgoing connection checking finding of the defective spare parts removing of all moisture content with suitable grade chemical replacement of rusted nuts bolts and washer replacement of all unserviceable post insulator and repair of all busbar joints and covered with ht insulation tape complete external surface as per existing colour and quality replacemnt of all defective internal ac dc circuit wiring repair servicing of breaker trolly including motorized operating mechanism ct pt power pack and calibration of triping relays system and tripping mechanism for regulating the fault flow over current earth fault differential in sequence from down streem to receiving sub stn for accuracy and effective functioning of vcb complete all as specified and as directed note nuts bolts washer cleaning material insulation tape copper wire for circuit wiring and defective ht 11 kv 2 amp fuse carrier oiling greasing to charging spring replacement of hrc fuse 110 220 volt 5 amps setting of over current earth fault relays complete other minor items for repair of breaker shall be deemed in qouated rate replacement of major unserviceable spares accessories shall be measured and paid separately under relevant items , supply and fixing heater 230 volts ac 60 watt for 11 kv ht vcb panel complete all as specifed and as directed make heatco vileco electrical , supply and fixing in replecement of spring charging gear for 11kv vcb panel suitable for 630 400 amp complete all as specified and directed , supply and fixing vacuum interputer for ht11 kv vcbs 630 400 amps brakding capacity 13point 1 ka suitable for alstom make vcb complete all as specified and as directed , taking down and repairing overhauling of air break gang operated switch with do fuse unit 200 amp 400 amp capacity triple pole mechanically operated mounted on insulators and steel frame installed vertically horizontally replacement of broken worn out components oiling and greasing of mechanical moving parts smoothing and polishing of electric contacts with providing conducting jelly of contacts refixed the sam

State Government

CTN :44310754

09 Mar, 2026 4.95 Lacs

Mandi - Himachal Pradesh

Tender For hiring of earth cutting/ excavating machine for removal of slips/ dressing of berms, clearance of side drains etc. (i) purana kataula kundakh road km 0/00 to 6/750 (ii) segali prasher road km 0/0 to 22/510 (iii) kataula bodandhar kundakh tihri kalang - restoration of rain damages on various roads in kataula section under kamand sub-division hppwd, kamand. (sh:- hiring of earth cutting/ excavating machine for removal of slips/ dressing of berms, clearance of side drains etc. (i) purana kataula kundakh road km 0/00 to 6/750 (ii) segali prasher road km 0/0 to 22/510 (iii) kataula bodandhar kundakh tihri kalang patons road km 0/0 to 16/750 and others roads etc.)

Central Government/Public Sector

CTN :44060793

10 Mar, 2026 89.52 Lacs

Barh - Bihar

Tender For corrigendum : removal of excess earth from premises of switchyard ntpc barh

CTN :44316793

11 Mar, 2026 42.36 Lacs

Alappuzha - Kerala

Tender For general vettiykkal rectification removal of accumulated earth and rectificationtobothdamagedbanksofvettiykkalthoduatvettiykkalpadashekharaminward no. 2 of pallippad panchayath.-general civil work.

State Government

CTN :44310756

09 Mar, 2026 4.95 Lacs

Mandi - Himachal Pradesh

Tender For hiring of earth cutting/ excavating machine for removal of slips/ debris dressing of berms, clearing of drains and catch pit etc. for opening of roads (i) cheli to silhikhad road (ii) shingari babli chhahri road (iii) pali baragaon road (iv) sajoun k

Central Government/Public Sector

CTN :44291619

10 Mar, 2026 NA

Multi City - Chhattisgarh

Tender For scope of work (sow) as mentioned in tender and schedule of work( 52 )items as given below ,[1] earth wrk,excav in trench etc,thk127mm 50.000 m3,[32] soling,single brick flat,cl50 100.000 m2,[33] taking,false ceiling w/bead,frame 150.000 m2,[34] supply and erection pvc floor,thk2mm 1000.000 ft2,[35] fixg 60mm thick decorative paver blocks 75.000 m2,[36] prvdg,french plsng/varnishing on door 100.000 m2,[37] supply,fitg,fixg,venetian blinds 100.000 m2,[38] fixg approve lamination on door/any area 50.000 m2,[39] supply&laying chequered tile,thk30mm 100.000 m2,[40] fixg,interlock angle f/steel door,godrej 15.000 ea,[41] prvdg acoustic wall paneling,

Central Government/Public Sector

CTN :44196222

16 Mar, 2026 NA

Multi City - Chhattisgarh

Tender For scope of work (sow) as mentioned in tender and schedule of work( 30 )items as given below ,[1] repl def street light & indoor lights 550.000 ea,[2] repl def hm, focus lights 200/350/120w 550.000 ea,[3] disman of light fitg 700.000 ea,[4] supply of 200w led flood light 180.000 ea,[5] supply of 120w led street light 600.000 ea,[6] supply of 350w led flood light himast 250.000 ea,[7] supply of 18w led tube light 450.000 ea,[8] supply of 120w led flood light 150.000 ea,[9] supply of 35 w led well glass 200.000 ea,[10] repair jb, marsh box for hm/tower light 350.000 ea,[11] repair/repl jb, db, mb for streetlight 1100.000 ea,[12] maintenance/service/repair of high mast 300.000 ea,[13] earth excav&backfilg,cbl 1200.000 m3,[14] instln medium gauge gi pipe 4in w/fitg 150.000 m,[15] jtng,cbl 200.000 ea,[16] layg 1.1kv,4cx25mm2,pvc insul,al.cable 3000.000 m,[17] cutg,jungle 5000.000 m2,[18] clng,area including removal of scrap 10000.000 le,[19] paintg of streetlight pole al, red oxide 500.000 ea,[20] ern,street light pole,9m 75.000 ea,[21] arranging platform truck with operator 150.000 ea,[22] replacement of def mcb, contactor etc 350.000 ea,[23] installation of decorative led lights 100.000 ea,[24] attending lighting complaints 900.000 ea,[25] disconnect&reconnect street light fitg 4.000 ea,[26] instln,ceiling fan,1200mm sweep 88.000 ea,[27] point wiring,light,fans/exhaust,5/15a pt 191.000 ea,[28] refixg loose hang wiring on wall/ceiling 2000.000 m,[29] instln,tpn cfs,200/100a 10.000 ea,[30] disman,damaged db,cfs,jb etc 24.000 le

Central Government/Public Sector

CTN :43698963

10 Mar, 2026 2.99 Crore

Poonch - Jammu And Kashmir

Tender For corrigendum : provn of dry ration stores under ge 881 ews - sch a part-i (building work):-this schedule is not pre-priced by mes and the pre-priced rate indicated as "rs. 0.00" under col.5 signifies this fact only., construction of block of storage shed complete all as shown on drawings and as specified., total amount of sch a part - ii (site clearance/development work), total amount of sch a part - iii (internal electric supply work), total amount of sch a part - iv (protective work), total amount of sch a part - v (area drainage work), total amount of sch a part -vi (road, path and culvert work), total amount of sch a part -vii (external electric supply work), total amount of sch a part -viii (demolition/dismantling work), sch a part - ix (misc items of work) note : this schedule is not pre-priced by mes and the pre-priced rate indicated as "rs. 0.00" under col.5 signifies this fact only., double walled corrugated (dwc) pipe for cable protection with outer dia 50mm and inner dia 38mm including suitable size of coupler for connection of pipe complete all as specified and directed., point wiring for one light/fan point/call bell point controlled by one way switch 5 amp with 1.5 sqmm single core multi standed copper conductor frlsh insulated and unsheathed heavy duty cable in colour code including earth wire with cable of size 1.5 sqmm copper conductor frlsh insulated, drawn into and including concealed in pvc conduit of not less than 20mm dia and 1.5mm wall thickness (isi marked) terminated into annealed steel terminal boxes including modular plate and cover for mounting modular switch/ socket switches, sockets, fan regulators etc complete all as specified and directed., all as per srl item no. 12.00 above but for one 3 pin 5 amp socket on same board., all as per srl item no. 12.00 above but for one 3 pin 5 amp socket on independent board., earthing complete with galvanized steel earth plate electrode 600x600x6mm burried directly in ground (earth pit not less than 2.25 m deep below ground level) with top edge of earth plate not less than 1.5m below normal ground level connected with galvanized iron earth lead wire 4mm dia by means of bolts, nuts, check nuts and washers of galvanized iron or steel complete with 15mm dia gi light grade protection pipe, 20mm dia gi medium grade watering pipe with funnel including charcoal, dust, salt, pcc m-15 type b1 in pit with angle iron (25x25x3)mm frame work with precast rcc 1:2:4 type b-1 cover reinforced with 8mm dia tmt bars @ 150mm c/c both ways and 12mm dia ms fabricated handle, test point etc. in and including light grade gi protection pipe 20mm bore up to 7.5m length for drawing in earth lead wire, all as shown in electric plate no. 3 of ssr part-i complete with necessary earth work in any type of soil, removal of soil to a distance not exc. 50m, testing on completion complete all as specified and directed.note:- on testing after completion of earthing, if desired earth resistance is not obtained, the earthing will be re-done by the contractor at his own risk & cost to the entire satisfaction., inverter led light fittings batten type, 1x20w led, 230v, complete with all accessories internally per wired including lithium lon battery with charging time 8 to 10 hours and back up time up to 4 hours and connecting up with pvc insulated and sheathed, 1100 v grade, flexible, multistranded copper conductor three core cable complete all as specified and directed., led street light/ security light fitting 35 watt, 230 v, ac, outdoor type with high pressure die cast aluminium hosing and heat resistant complete with driver, lamp bracket with impact and corrosion resistant including thermal management in multiple optics complete with ip 66 protection, including provision of gi bracket made of 40mm dia, gi pipe, 1.5m long, bend to shape, complete all as specified., mcb, spn, 240 volts, 40 to 63 amps,10ka, breaking capacity, complete all as specified., mcb, spn, 240 volts, 6 to 32 amps,10ka, brea

Central Government/Public Sector

CTN :44137068

09 Mar, 2026 1.24 Crore

Sonbhadra - Uttar Pradesh

Tender For leaning and removal of silt/earth from nallah/siltation area of mine towards ob time office along railway line up to double barrel culvert and ntpc boundary wall at khadia project during monsoon 2026-27

State Government

CTN :44217481

09 Mar, 2026 NA

Purba Medinipur - West Bengal

Tender For dredging/desilting/removal and disposal of entire quantity of canal bed earth / clay from ch. 0.00 k.m to ch. 5.500 k.m for a total length 5.500 k.m of 1 main canal within the site location of 1 main canal in panskura-i development block, purba medin

Bandalling Tenders

By Cities

By States

By Agencies

By Ownerships

By Sectors